Skip to main contentSkip to main content

TB-500 (Thymosin Beta-4) Testing Services

TB-500 is a synthetic version of Thymosin Beta-4, a naturally occurring peptide present in all human and animal cells. It is central to in cell migration, wound healing, and tissue repair processes.

Research Applications

Common research areas for TB-500 (Thymosin Beta-4)

  • Wound healing research
  • Muscle injury studies
  • Cardiovascular research
  • Inflammation studies

Peptide Information

Molecular details and sample requirements

Sequence / Structure:

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Weight

4963.44 g/mol

Formula

C212H350N56O78S

Recommended Purity

≥98%

Sample Size

1-2 mg lyophilized

Our TB-500 (Thymosin Beta-4) Testing Services

Comprehensive analytical testing to ensure TB-500 (Thymosin Beta-4) quality and purity

Ready to test your peptides?

Send your peptide name, sample count, and the tests you need. We return a fixed-price quote, usually within one business day.

  • validated analytical methods, independent of any supplier
  • 9-11 business day standard turnaround
  • Traceable COA with chromatograms and method parameters

TB-500 (Thymosin Beta-4) Testing Methodology

Our analytical workflow for TB-500 (Thymosin Beta-4) follows USP <1225> guidance for validated chromatographic methods. Each lot is processed by a credentialed analyst with documented chain of custody.

  1. Step 1

    Sample intake & chain of custody

    Your TB-500 (Thymosin Beta-4) sample (1-2 mg lyophilized) is logged at our Florida lab with a unique ID, photographed, and stored at -20 °C until analysis.

  2. Step 2

    Reverse-phase HPLC purity

    TB-500 (Thymosin Beta-4) is dissolved in mobile phase and run on a C18 column with a water/acetonitrile gradient containing 0.1% TFA. UV detection at 214 nm quantifies the main peak and any related impurities.

  3. Step 3

    LC-MS identity confirmation

    An aliquot is analyzed by liquid chromatography-mass spectrometry. The observed monoisotopic mass is compared against the theoretical molecular weight (4963.44 g/mol) for TB-500 (Thymosin Beta-4) to confirm identity.

  4. Step 4

    Impurity profiling & reporting

    Related substances, truncations, and oxidation products are quantified. Findings are compiled into a signed Certificate of Analysis with chromatograms, mass spectra, and analyst interpretation.

TB-500 (Thymosin Beta-4) Purity Notes

Recommended research-grade purity for TB-500 (Thymosin Beta-4) is ≥98%. Lot-to-lot variation is common with solid-phase synthesis, so independent verification matters.

Common impurities to watch

  • Truncated sequences from incomplete coupling
  • Deletion peptides missing one or more residues
  • Oxidation of methionine, tryptophan, or cysteine
  • Residual TFA, acetate, or solvent counter-ions
  • Aggregates and dimers from improper storage

What our COA confirms

  • Main peak purity by HPLC area %
  • Observed vs theoretical mass (4963.44 g/mol)
  • Named impurities ≥ 0.1% area
  • Net peptide content where applicable
  • Method, column, and instrument metadata

TB-500 (Thymosin Beta-4) Handling, Storage & Safety

Guidance below is for laboratory and research personnel only. TB-500 (Thymosin Beta-4) is supplied for research use and is not intended for human or veterinary use.

Storage

Store lyophilized TB-500 (Thymosin Beta-4) at -20 °C, protected from light and moisture. After reconstitution, aliquot and store at -80 °C; avoid repeated freeze-thaw cycles.

Reconstitution

Reconstitute in bacteriostatic or sterile water in a clean environment. Allow vials to reach room temperature before opening to prevent moisture condensation on the powder.

PPE & shipping

Handle with gloves, lab coat, and eye protection. Ship samples to ACS overnight on dry ice or cold packs in a rigid, leak-proof container with a packing slip referencing your quote.

This page is informational and does not constitute medical advice. Consult your institution's safety officer and SDS before working with TB-500 (Thymosin Beta-4).

Get Your TB-500 (Thymosin Beta-4) Tested Today

Contact us for a detailed quote and learn how our US laboratory COA can verify your TB-500 (Thymosin Beta-4) quality

People Also Ask: TB-500 (Thymosin Beta-4) Testing