Skip to main contentSkip to main content

Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Testing Services

Glow is a popular multi-peptide blend combining GHK-Cu (copper peptide), BPC-157, and TB-500 (Thymosin Beta-4). This regenerative blend is frequently encountered in aesthetic medicine, wellness clinics, and tissue repair research. Testing each component individually is critical for verifying identity, purity, and correct ratios.

Research Applications

Common research areas for Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500)

  • Aesthetic medicine research
  • Tissue regeneration studies
  • Wound healing investigations
  • Multi-peptide formulation quality control
  • Compounding pharmacy verification

Peptide Information

Molecular details and sample requirements

Sequence / Structure:

GHK-Cu: Gly-His-Lys·Cu²⁺ | BPC-157: GEPPPGKPADDAGLV | TB-500: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Weight

Blend (~403 + 1419 + 4963 g/mol)

Formula

Multi-component blend

Recommended Purity

≥95% per component

Sample Size

2-3 mg lyophilized

Our Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Testing Services

Comprehensive analytical testing to ensure Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) quality and purity

Ready to test your peptides?

Send your peptide name, sample count, and the tests you need. We return a fixed-price quote, usually within one business day.

  • validated analytical methods, independent of any supplier
  • 9-11 business day standard turnaround
  • Traceable COA with chromatograms and method parameters

Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Testing Methodology

Our analytical workflow for Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) follows USP <1225> guidance for validated chromatographic methods. Each lot is processed by a credentialed analyst with documented chain of custody.

  1. Step 1

    Sample intake & chain of custody

    Your Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) sample (2-3 mg lyophilized) is logged at our Florida lab with a unique ID, photographed, and stored at -20 °C until analysis.

  2. Step 2

    Reverse-phase HPLC purity

    Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) is dissolved in mobile phase and run on a C18 column with a water/acetonitrile gradient containing 0.1% TFA. UV detection at 214 nm quantifies the main peak and any related impurities.

  3. Step 3

    LC-MS identity confirmation

    An aliquot is analyzed by liquid chromatography-mass spectrometry. The observed monoisotopic mass is compared against the theoretical molecular weight (Blend (~403 + 1419 + 4963 g/mol)) for Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) to confirm identity.

  4. Step 4

    Impurity profiling & reporting

    Related substances, truncations, and oxidation products are quantified. Findings are compiled into a signed Certificate of Analysis with chromatograms, mass spectra, and analyst interpretation.

Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Purity Notes

Recommended research-grade purity for Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) is ≥95% per component. Lot-to-lot variation is common with solid-phase synthesis, so independent verification matters.

Common impurities to watch

  • Truncated sequences from incomplete coupling
  • Deletion peptides missing one or more residues
  • Oxidation of methionine, tryptophan, or cysteine
  • Residual TFA, acetate, or solvent counter-ions
  • Aggregates and dimers from improper storage

What our COA confirms

  • Main peak purity by HPLC area %
  • Observed vs theoretical mass (Blend (~403 + 1419 + 4963 g/mol))
  • Named impurities ≥ 0.1% area
  • Net peptide content where applicable
  • Method, column, and instrument metadata

Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Handling, Storage & Safety

Guidance below is for laboratory and research personnel only. Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) is supplied for research use and is not intended for human or veterinary use.

Storage

Store lyophilized Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) at -20 °C, protected from light and moisture. After reconstitution, aliquot and store at -80 °C; avoid repeated freeze-thaw cycles.

Reconstitution

Reconstitute in bacteriostatic or sterile water in a clean environment. Allow vials to reach room temperature before opening to prevent moisture condensation on the powder.

PPE & shipping

Handle with gloves, lab coat, and eye protection. Ship samples to ACS overnight on dry ice or cold packs in a rigid, leak-proof container with a packing slip referencing your quote.

This page is informational and does not constitute medical advice. Consult your institution's safety officer and SDS before working with Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500).

Get Your Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Tested Today

Contact us for a detailed quote and learn how our US laboratory COA can verify your Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) quality

People Also Ask: Glow Peptide Blend (GHK-Cu + BPC-157 + TB-500) Testing