Skip to main contentSkip to main content

LL-37 (Cathelicidin) Testing Services

LL-37 is the only human cathelicidin antimicrobial peptide. It is widely studied for its antimicrobial, immunomodulatory, and wound-healing roles, with research interest spanning infectious disease, dermatology, and inflammation.

Research Applications

Common research areas for LL-37 (Cathelicidin)

  • Antimicrobial peptide research
  • Wound healing studies
  • Innate immunity research
  • Dermatology research

Peptide Information

Molecular details and sample requirements

Sequence / Structure:

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Molecular Weight

4493.33 g/mol

Formula

C205H340N60O53

Recommended Purity

≥95%

Sample Size

1-2 mg lyophilized

Our LL-37 (Cathelicidin) Testing Services

Comprehensive analytical testing to ensure LL-37 (Cathelicidin) quality and purity

Ready to test your peptides?

Send your peptide name, sample count, and the tests you need. We return a fixed-price quote, usually within one business day.

  • validated analytical methods, independent of any supplier
  • 9-11 business day standard turnaround
  • Traceable COA with chromatograms and method parameters

LL-37 (Cathelicidin) Testing Methodology

Our analytical workflow for LL-37 (Cathelicidin) follows USP <1225> guidance for validated chromatographic methods. Each lot is processed by a credentialed analyst with documented chain of custody.

  1. Step 1

    Sample intake & chain of custody

    Your LL-37 (Cathelicidin) sample (1-2 mg lyophilized) is logged at our Florida lab with a unique ID, photographed, and stored at -20 °C until analysis.

  2. Step 2

    Reverse-phase HPLC purity

    LL-37 (Cathelicidin) is dissolved in mobile phase and run on a C18 column with a water/acetonitrile gradient containing 0.1% TFA. UV detection at 214 nm quantifies the main peak and any related impurities.

  3. Step 3

    LC-MS identity confirmation

    An aliquot is analyzed by liquid chromatography-mass spectrometry. The observed monoisotopic mass is compared against the theoretical molecular weight (4493.33 g/mol) for LL-37 (Cathelicidin) to confirm identity.

  4. Step 4

    Impurity profiling & reporting

    Related substances, truncations, and oxidation products are quantified. Findings are compiled into a signed Certificate of Analysis with chromatograms, mass spectra, and analyst interpretation.

LL-37 (Cathelicidin) Purity Notes

Recommended research-grade purity for LL-37 (Cathelicidin) is ≥95%. Lot-to-lot variation is common with solid-phase synthesis, so independent verification matters.

Common impurities to watch

  • Truncated sequences from incomplete coupling
  • Deletion peptides missing one or more residues
  • Oxidation of methionine, tryptophan, or cysteine
  • Residual TFA, acetate, or solvent counter-ions
  • Aggregates and dimers from improper storage

What our COA confirms

  • Main peak purity by HPLC area %
  • Observed vs theoretical mass (4493.33 g/mol)
  • Named impurities ≥ 0.1% area
  • Net peptide content where applicable
  • Method, column, and instrument metadata

LL-37 (Cathelicidin) Handling, Storage & Safety

Guidance below is for laboratory and research personnel only. LL-37 (Cathelicidin) is supplied for research use and is not intended for human or veterinary use.

Storage

Store lyophilized LL-37 (Cathelicidin) at -20 °C, protected from light and moisture. After reconstitution, aliquot and store at -80 °C; avoid repeated freeze-thaw cycles.

Reconstitution

Reconstitute in bacteriostatic or sterile water in a clean environment. Allow vials to reach room temperature before opening to prevent moisture condensation on the powder.

PPE & shipping

Handle with gloves, lab coat, and eye protection. Ship samples to ACS overnight on dry ice or cold packs in a rigid, leak-proof container with a packing slip referencing your quote.

This page is informational and does not constitute medical advice. Consult your institution's safety officer and SDS before working with LL-37 (Cathelicidin).

Get Your LL-37 (Cathelicidin) Tested Today

Contact us for a detailed quote and learn how our US laboratory COA can verify your LL-37 (Cathelicidin) quality

People Also Ask: LL-37 (Cathelicidin) Testing