LL-37 (Cathelicidin) Testing Services
LL-37 is the only human cathelicidin antimicrobial peptide. It is widely studied for its antimicrobial, immunomodulatory, and wound-healing roles, with research interest spanning infectious disease, dermatology, and inflammation.
Research Applications
Common research areas for LL-37 (Cathelicidin)
- Antimicrobial peptide research
- Wound healing studies
- Innate immunity research
- Dermatology research
Peptide Information
Molecular details and sample requirements
Sequence / Structure:
[LL-37, 37 aa]
Molecular Weight
4493.33 g/mol
Formula
C205H340N60O53
Recommended Purity
≥95%
Sample Size
1-2 mg lyophilized
Our LL-37 (Cathelicidin) Testing Services
Comprehensive analytical testing to ensure LL-37 (Cathelicidin) quality and purity
Purity Testing
HPLC analysis to verify LL-37 (Cathelicidin) purity levels
Identity Verification
Mass spectrometry to confirm molecular identity
Third-Party Verification
Independent COA verification for LL-37 (Cathelicidin)
Certificate of Analysis
Official US laboratory documentation
Ready to test your peptides?
Send your peptide name, sample count, and the tests you need. We return a fixed-price quote, usually within one business day.
- validated analytical methods, independent of any supplier
- 9-11 business day standard turnaround
- Traceable COA with chromatograms and method parameters
LL-37 (Cathelicidin) Testing Methodology
Our analytical workflow for LL-37 (Cathelicidin) follows USP <1225> guidance for validated chromatographic methods. Each lot is processed by a credentialed analyst with documented chain of custody.
Step 1
Sample intake & chain of custody
Your LL-37 (Cathelicidin) sample (1-2 mg lyophilized) is logged at our Florida lab with a unique ID, photographed, and stored at -20 °C until analysis.
Step 2
Reverse-phase HPLC purity
LL-37 (Cathelicidin) is dissolved in mobile phase and run on a C18 column with a water/acetonitrile gradient containing 0.1% TFA. UV detection at 214 nm quantifies the main peak and any related impurities.
Step 3
LC-MS identity confirmation
An aliquot is analyzed by liquid chromatography-mass spectrometry. The observed monoisotopic mass is compared against the theoretical molecular weight (4493.33 g/mol) for LL-37 (Cathelicidin) to confirm identity.
Step 4
Impurity profiling & reporting
Related substances, truncations, and oxidation products are quantified. Findings are compiled into a signed Certificate of Analysis with chromatograms, mass spectra, and analyst interpretation.
LL-37 (Cathelicidin) Purity Notes
Recommended research-grade purity for LL-37 (Cathelicidin) is ≥95%. Lot-to-lot variation is common with solid-phase synthesis, so independent verification matters.
Common impurities to watch
- Truncated sequences from incomplete coupling
- Deletion peptides missing one or more residues
- Oxidation of methionine, tryptophan, or cysteine
- Residual TFA, acetate, or solvent counter-ions
- Aggregates and dimers from improper storage
What our COA confirms
- Main peak purity by HPLC area %
- Observed vs theoretical mass (4493.33 g/mol)
- Named impurities ≥ 0.1% area
- Net peptide content where applicable
- Method, column, and instrument metadata
LL-37 (Cathelicidin) Handling, Storage & Safety
Guidance below is for laboratory and research personnel only. LL-37 (Cathelicidin) is supplied for research use and is not intended for human or veterinary use.
Storage
Store lyophilized LL-37 (Cathelicidin) at -20 °C, protected from light and moisture. After reconstitution, aliquot and store at -80 °C; avoid repeated freeze-thaw cycles.
Reconstitution
Reconstitute in bacteriostatic or sterile water in a clean environment. Allow vials to reach room temperature before opening to prevent moisture condensation on the powder.
PPE & shipping
Handle with gloves, lab coat, and eye protection. Ship samples to ACS overnight on dry ice or cold packs in a rigid, leak-proof container with a packing slip referencing your quote.
This page is informational and does not constitute medical advice. Consult your institution's safety officer and SDS before working with LL-37 (Cathelicidin).
Related Peptides
TB-500 (Thymosin Beta-4) Testing
TB-500 is a synthetic version of Thymosin Beta-4, a naturally occurring peptide ...
Melanotan II Testing
Melanotan II is a synthetic analog of alpha-melanocyte-stimulating hormone (α-MS...
GHRP-6 Testing
GHRP-6 (Growth Hormone Releasing Peptide-6) is a synthetic hexapeptide that stim...